SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8AVN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8AVN4
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily Prim-pol domain 1.77e-19
Family Bifunctional DNA primase/polymerase N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8AVN4
Sequence length 300
Comment (tr|F8AVN4|F8AVN4_FRADG) Bifunctional DNA primase/polymerase {ECO:0000313|EMBL:AEH11005.1} KW=Complete proteome; Reference proteome OX=656024 OS=Frankia symbiont subsp. Datisca glomerata. GN=FsymDg_3728 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MSGPAPALLAAAESYIEAGWPVFVLGRTKRPVANCPRCRDAGRDHDPEACACLSCHGFYA
ATLDLDRVAAMLSAAPRGLLAIRTGALAGLVVVDIDPGHGGRLDPALMTPTAAVASGGGG
WHLYYAHPGPPVLSRRLPGRTGVDVKADGGYVVAPPSIHPVTRTPYRWTARQTVGEMPPP
LHAAVTAPAAPSSQPTRPPATAGPPARRPTGGDDSAGGGISRPDLLLAAHLAAVARAPEG
HRRTTLYGAARGVARLVAADHLTATEAWAALADAGRAAAQTEREIRGAITGGFRDEGVPL
Download sequence
Identical sequences F8AVN4
WP_013874885.1.39566 gi|336179551|ref|YP_004584926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]