SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8B4L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8B4L8
Domain Number 1 Region: 23-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.32e-16
Family GntR-like transcriptional regulators 0.011
Further Details:      
 
Domain Number 2 Region: 110-234
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000068
Family GntR ligand-binding domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8B4L8
Sequence length 264
Comment (tr|F8B4L8|F8B4L8_FRADG) Regulatory protein GntR HTH {ECO:0000313|EMBL:AEH07962.1} KW=Complete proteome; Reference proteome OX=656024 OS=Frankia symbiont subsp. Datisca glomerata. GN=FsymDg_0405 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MTVRTTMAVNMFGPERGPRFSKFSELVADDLRGRMARGEVRPGEHLPPESELMDVYGVAR
PTMREALRILESESLIVLRRGSHLGPLVQEPDTRVLARQTGLRLQMQGTSVRDLLEARAV
IEPGAVALAAARRSGSDLRGMRDCLLAASRSRGILDFSRPSAEFRILVVRSSHNRTLILM
AELVSALLRKEHEAALRNIPEAAGQQFIRRSLARYERLTDLIENQDVRGAVEFWQDNGTT
DTELETELETDNAAQPGPMLAVYS
Download sequence
Identical sequences F8B4L8
gi|336176508|ref|YP_004581883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]