SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8F614 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8F614
Domain Number 1 Region: 54-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000314
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 180-245
Classification Level Classification E-value
Superfamily ClpS-like 0.0000262
Family Ribosomal protein L7/12, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8F614
Sequence length 261
Comment (tr|F8F614|F8F614_PAEMK) Uncharacterized protein {ECO:0000313|EMBL:AEI41902.1} KW=Complete proteome OX=1036673 OS=Paenibacillus mucilaginosus (strain KNP414). GN=KNP414_03344 OC=Paenibacillus.
Sequence
METVYQEIDAVIAKMQAALEEKREQHPDHYAKYPMQLMTTAEDQALRSVTGTWSLPEEYL
YFLKHYVPESVSWSTDEYMNMDIYGAKDLLQGQSGYNYNHVTDEVIADWPRDYLVIASDE
GDPYCIDLSRGDTVIYTAAHGAGSWDFSVAYDNLLEFLHSMLRPASTGEWEDGADEPYDY
CHVYITGPGTDKIKTWVFIKKRFSCDYAQAKTYLEAAPLLVYKGLDSGAVKLVDELKSIG
ADYELRQISQDEFLGIGSYRS
Download sequence
Identical sequences F8F614
gi|337747610|ref|YP_004641772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]