SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8KTL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8KTL9
Domain Number - Region: 20-162
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0235
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8KTL9
Sequence length 334
Comment (tr|F8KTL9|F8KTL9_HELBC) Uncharacterized protein {ECO:0000313|EMBL:CCB80189.1} KW=Complete proteome; Reference proteome OX=1002804 OS=Helicobacter bizzozeronii (strain CIII-1). GN=HBZC1_12030 OC=Helicobacteraceae; Helicobacter.
Sequence
MPVKVDTQQACQAITQLCFFRDDLYQKRHDFLQELQEYYEAICEEKRRTENLLGQAREGL
AAARAYEAACEAALAMADEEDEAAAEADLAEAIAIREQWEQKVALLEQALEIYTEQVKRI
ETQILQETYQQSKSLLLAYNKEHSQLCRRSSQAINIIEKQYNRPPPMPPPGLQALFARLE
ALQKRLDPKFKITQIQMANENYKEFLQRHKESFVAKSSDIPWSEWNLPLFPAVFSTTIGL
EHLGEEKPMLAFRALKALQKALEERPSLQELFNEEEQLQINKGITPKGYLWHFDGNPPLG
TMQLVREEILLKVPHTKGYPLWQSTAEQLKTGIL
Download sequence
Identical sequences F8KTL9
WP_013890608.1.34921 gi|336453435|ref|YP_004607901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]