SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8L3T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8L3T6
Domain Number 1 Region: 31-232
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.47e-53
Family DNA/RNA non-specific endonuclease 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8L3T6
Sequence length 235
Comment (tr|F8L3T6|F8L3T6_SIMNZ) Endonuclease G, mitochondrial {ECO:0000313|EMBL:CCB89958.1} KW=Complete proteome; Reference proteome OX=331113 OS=Simkania negevensis (strain ATCC VR-1471 / Z). GN=SNE_A20810 OC=Bacteria; Chlamydiae; Parachlamydiales; Simkaniaceae; Simkania.
Sequence
MAKKTLGFFLGLAIGSSSVFVYDQMQHRGHPSGFPVLERMGYTMSYDTRAKIPFWTHERL
TKDSLEVHTERSGMDFKEDEEIYPLHRSQLCDYYQSGFDRGHHAPAANHRLSEEELRETF
LLTNISPQDAQFNRGLWAKLEKIIRILAKEADWVEVTTGPLFLAHDEADGRRLVTYQVIG
KNDVAVPTHFFKVINTPDRSWAYVIPNGPAKGSLSDYITPISEIEKLAGIRLTNL
Download sequence
Identical sequences F8L3T6
gi|338733976|ref|YP_004672449.1| WP_013944424.1.32353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]