SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8MBD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8MBD1
Domain Number 1 Region: 249-409
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.7e-61
Family eEF1-gamma domain 0.0000313
Further Details:      
 
Domain Number 2 Region: 72-206
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.96e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.99e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8MBD1
Sequence length 409
Comment (tr|F8MBD1|F8MBD1_NEUT8) Uncharacterized protein {ECO:0000313|EMBL:EGO61096.1} KW=Complete proteome OX=510951 OS=Neurospora tetrasperma (strain FGSC 2508 / ATCC MYA-4615 / P0657). GN=NEUTE1DRAFT_115978 OC=Neurospora.
Sequence
MAFGKLYTYEANPRSTAILAVAKANNLDLEVVKVDLEAAIEEYKKVNPLGKVPTFVGADG
YTLFECIAIAIYVASQNEKTTLLGKTKQDYASILKWLSFFNTEVLPPLAGWYRPLLGKAP
YNKKAVEDAQATALKAISVAEAHLKNNTFLVGERITLADLFATGIIARGFEFFFDKAWRE
QYPNVTRWYTTVYNQPIYSAVAPPFALLDTPKLTNVAPKKAEAPKPAAAPKPAAAPAAAA
EEPAEAPKPKHPLEALPRASFPLDEWKRQYSNVDTPEALKWFWENVPFTEYSIWKVNYKY
NDELTLTFMSNNLIGGFNNRLEASRKYLFGCASVYGTNNDSVIQGAFVIRGDDWKPVFDV
APDYESYEFTKLDPQNPEDRAFVEAEWSWDKPALVNGKEYPHASGKVFK
Download sequence
Identical sequences F8MBD1 G4UDP4
jgi|Neute1|190971|estExt_fgenesh2_kg.C_330017 XP_009848228.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]