SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8W254 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8W254
Domain Number 1 Region: 198-447
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-70
Family Nuclear receptor ligand-binding domain 0.000000000855
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8W254
Sequence length 458
Comment (tr|F8W254|F8W254_DANRE) RAR-related orphan receptor A, paralog a {ECO:0000313|Ensembl:ENSDARP00000124850} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=roraa OC=Cyprinidae; Danio.
Sequence
XQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQKNCLIDRTSRNRC
QHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQRDHQQQPGEAEPLTPT
YGLSTNGLTELHDDLSGYMNGHTPDGTKPDSGVSSFYLDIQPSPDQSGLDINGIKPEPIC
DFTPGSGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHMETCQYLREELQQMTWQAFLQ
EEVENYQSKPREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVF
VRMCRAFDPQNNTVYFDGKYAGPDVFKSLGCDDLISSVFEFGKNLCSMHLSEDEIALFSA
FVLMSADRSWLQEKVKVEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCSRHT
EKLTAFKAIYPDIVRAHFPPLYKELFGSDFEQSMPVDG
Download sequence
Identical sequences F8W254
ENSDARP00000124850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]