SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8W889 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8W889
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 279-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8W889
Sequence length 615
Comment (tr|F8W889|F8W889_HUMAN) Zinc finger protein 181 {ECO:0000313|Ensembl:ENSP00000376065} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF181 OC=Catarrhini; Hominidae; Homo.
Sequence
MPQLQYPEGYLAPNRCLVSNCGVNKMSNDELVGQNHGMEGEACIGGDVTFNDVAIDFTHE
EWGWLSSAQRDLYKDVMVQNYENLVSVAGLSVTKPYVITLLEDGKEPWMMEKKLSKGMIP
DWESRWENKELSTKKDNYDEDSPQTVIIEKVVKQSYEFSNSKKNLEYIEKLEGKHGSQVD
HFRPAILTSRESPTADSVYKYNIFRSTFHSKSTLSEPQKISAEGNSHKYDILKKNLPKKS
VIKNEKVNGGKKLLNSNKSGAAFSQGKSLTLPQTCNREKIYTCSECGKAFGKQSILNRHW
RIHTGEKPYECRECGKTFSHGSSLTRHLISHSGEKPYKCIECGKAFSHVSSLTNHQSTHT
GEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYECRICGKAFIHRSSLIHHQKIHTGEKP
YECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQ
KCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPYECIKCGK
TFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHNGEKPNSVVSVEKPLDY
MNHYTCEKSYRRETV
Download sequence
Identical sequences F8W889
ENSP00000376065 ENSP00000376065 ENSP00000376065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]