SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8WDU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8WDU0
Domain Number - Region: 10-41
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0112
Family Di-heme elbow motif 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8WDU0
Sequence length 57
Comment (tr|F8WDU0|F8WDU0_HUMAN) TATA box-binding protein-associated factor RNA polymerase I subunit B {ECO:0000313|Ensembl:ENSP00000402955} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TAF1B OC=Catarrhini; Hominidae; Homo.
Sequence
MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTEYLTDYKVFGSIISFPPHH
Download sequence
Identical sequences F8WDU0
ENSP00000402955 ENSP00000402955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]