SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0CCF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0CCF3
Domain Number 1 Region: 27-74,104-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000209
Family SMI1/KNR4-like 0.022
Further Details:      
 
Domain Number 2 Region: 204-281,312-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000235
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0CCF3
Sequence length 373
Comment (tr|G0CCF3|G0CCF3_XANCA) Uncharacterized protein {ECO:0000313|EMBL:AEL08208.1} KW=Complete proteome OX=990315 OS=Xanthomonas campestris pv. raphani 756C. GN=XCR_3346 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAALEWKVYGRAPTLDTFWDEALNLGRSPATDASIAAAQARLGVRLPDWLRHLYARYDGG
AVQMARGQSLQQPDNWLAAEWLIPRARLLGAEALFSFAQVRVREDYRDDAYAGLAASGDD
RWLIAIAADARAPSRALCLDYAAPDTEPTLVYVDAGSGQRLIVFEGVEDLLAQLVDVVYW
SPALQAKYDDNERVQWQPQPPSLETFWSGPGHWSDALTVADTKALVAAEARLGVRLPALF
KRLYGVQDGGDTGWCWAPRTRFPSDRYVDWECVLVDRYLSPLAQIGSVLDFAAAFEDPHD
FSAVATLHAGLDQVLVLSSHNVDCLLCLDYRGRGPHYAPEVVYFERWEGLHSTWRAPSFE
AFFSTLRQADLDF
Download sequence
Identical sequences G0CCF3
WP_014508617.1.25266 gi|384428966|ref|YP_005638326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]