SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0ECM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0ECM9
Domain Number 1 Region: 20-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-48
Family Ribonuclease PH domain 1-like 0.00000224
Further Details:      
 
Domain Number 2 Region: 159-244
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-24
Family Ribonuclease PH domain 2-like 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0ECM9
Sequence length 248
Comment (tr|G0ECM9|G0ECM9_PYRF1) Exosome complex component Rrp41 {ECO:0000256|HAMAP-Rule:MF_00591} KW=Complete proteome; Reference proteome OX=694429 OS=Pyrolobus fumarii (strain DSM 11204 / 1A). GN=Pyrfu_1744 OC=Pyrodictiaceae; Pyrolobus.
Sequence
MAKREPPVPLITKTEEGRIVRHDGRAPDELRPIRMEVGVLSNADGSAYVEFGRTRVIAAV
YGPREVHPKHMALPDRALIRCRYHMAPFSTDERKSPAPTRREIELSKVIREALEPVVFTE
LYPRTTIDIFIEVIEADGGTRTAAVTAASLALADAGVQMRDLVAGVAVGKVQGVLVLDID
QLEDEYGEADMPVAMAPSLGWVTLLQLNGVLSREEFKEAMALARKGIEAIYKMQREALRR
KYAEVKTV
Download sequence
Identical sequences G0ECM9
WP_014027276.1.63292 gi|347524281|ref|YP_004781851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]