SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0ED14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0ED14
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-31
Family GHMP Kinase, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 182-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.75e-19
Family Homoserine kinase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0ED14
Sequence length 318
Comment (tr|G0ED14|G0ED14_PYRF1) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome; Reference proteome OX=694429 OS=Pyrolobus fumarii (strain DSM 11204 / 1A). GN=Pyrfu_0704 OC=Pyrodictiaceae; Pyrolobus.
Sequence
MVQHNRVRVKAPASIANLGPLFDLAALAIDYAYDVVEVEVVEELGDGIRVDVEAAGAPSG
EANTAYTAAYKILEYLGETLHLRIRVVKGVPPRMGMGGSGASAAAAAYAVNLLLGEPFTK
EELVKFAGEAEAVAAGTPHYDNVAASLLGGLVILLDRSRPWVARLNIPEDVYIILFIPKR
EVVKVPPGKGKTEVMREVLPREIPLATSIAWMEKALALTLGLQLDPYTALKAANYGGPVE
EARSKLIPGYAEAKREALEAGALAFNISGAGPTLFAIVREGDEDEVARRVAKILEKHWGE
LETRVVNIDREGARITSE
Download sequence
Identical sequences G0ED14
gi|347523255|ref|YP_004780825.1| WP_014026250.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]