SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0EFE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0EFE1
Domain Number 1 Region: 60-116,148-257
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 2.96e-40
Family NADH oxidase/flavin reductase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0EFE1
Sequence length 271
Comment (tr|G0EFE1|G0EFE1_PYRF1) SagB-type dehydrogenase domain protein {ECO:0000313|EMBL:AEM38184.1} KW=Complete proteome; Reference proteome OX=694429 OS=Pyrolobus fumarii (strain DSM 11204 / 1A). GN=Pyrfu_0312 OC=Pyrodictiaceae; Pyrolobus.
Sequence
MVSRRVFLQLITTSIMATLVTPLALILHAKRTYKRGPEVRVGEDCIDLPPPRLDGDVSLE
RSLANRRSIRDYLDEPLSIEEVSQLLWAAYGITETIHGFKTSPSAGATYPAEIYIVVGEK
GVTIGDEGYLEPGSYHYNPHAHRICVVKKGELRHELYKAALEQEWVLKAPVSIVVTVVFE
RTTRRYGERGIRYVWIEVGHIGQNIYLQATALGLGTVAVGAFLDEQVKKIIGAPESHNPA
YIMPVGRPVTPYTLDERELHAYIMAHREKST
Download sequence
Identical sequences G0EFE1
WP_014025861.1.63292 gi|347522866|ref|YP_004780436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]