SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0EG07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0EG07
Domain Number - Region: 521-564
Classification Level Classification E-value
Superfamily Prefoldin 0.0889
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0EG07
Sequence length 572
Comment (tr|G0EG07|G0EG07_PYRF1) Uncharacterized protein {ECO:0000313|EMBL:AEM39108.1} KW=Complete proteome; Reference proteome OX=694429 OS=Pyrolobus fumarii (strain DSM 11204 / 1A). GN=Pyrfu_1249 OC=Pyrodictiaceae; Pyrolobus.
Sequence
MGRVGLAVRLSTLIGMLLVMYLLSLVTGGFVLLANAVVVRAVSEPYIPLALRLALLALVS
AWGLPPLVRVLRVRRMRWHESLVTGVITALYAAALVAAFAYDAVLGLVTGATLLARVSLV
AQRGDRRRAALEAGLFTLLAVTLILVKLYVPVASARLLEEVRLGEPIDVNGLYRFIPLMT
AYVYALDRIQLPTHTVYAEDSYVYYIGNHSVYNWIIEPEGFWNQLTRSPRGIILVYGDSY
PPRVEIVERRLEWGLRNARFNGLYIDTLIRRVVLAAGLALRPIPENNMEVYLDGRVYILI
PLESWIRGPLETIPVLAGYAVVNEKGSIEVLSPEEVAERFPFIPLLPEAIARAWVETLRY
KPGFLQVYLYHNTFEVRDVGTNPQPYLTLDTRGRQWWVFVAEPPGRTYSAKYIIYVAANE
TSPRIRVYELPKPVVGVSMVESYVKQAHPVFDWEQLSIEEPIPAVIGGRVYWKVTVTTRD
YRGLVSVDIVDAETTRVYSLQPRHHIAYLDALKLIMGELGAKQPTEKSSKDILDRIGELE
EKIKRVREELDKILEELEEIKETLLNETLGQR
Download sequence
Identical sequences G0EG07
gi|347523790|ref|YP_004781360.1| WP_014026785.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]