SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0HWR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0HWR9
Domain Number 1 Region: 148-221
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000314
Family Transglutaminase, two C-terminal domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0HWR9
Sequence length 497
Comment (tr|G0HWR9|G0HWR9_HALHT) Uncharacterized protein {ECO:0000313|EMBL:AEM56612.1} KW=Complete proteome OX=634497 OS=102182 / NCIMB 2187 / VKM B-1755). GN=HAH_0994 OC=Haloarcula.
Sequence
MRHGVAVLACLVVVGSLPLSVAGASVNASISNVEVSPSSPAPGETVTFDTTVRNLESSDA
PLEINDIAIRKSGGRGITEYERVSNLGSIAPGSTLEVPLTASFDSSGSKDLRVIVYGRDR
GTGENVELRYPVKLNVKERHPQVDITANDSVAGVESTGEVTVANGLDTQITNVEVVVEGD
GVEMTKSRTVRSSVAQNGSITAPFRFRPESAGEHSLTATISYTVDGDTTRNTTRTTVIES
DPLRNSVELDTTAVGSGTDRALRVAVSNGGNAPLSDVMISATSENASFQRVLLENISAST
TRQVRLNATMDEPRADVTVTANYELGTETEQTTTETTLRSVPGTIDLTGLDVVRQGGRLQ
ISGSASNVGSTDADSVLVSVVNTETVTPATPNRDYFVGTVPASDFVSFDVYARTEGNVTS
VPLEVTYLVDDTRKRQTFDVNIDRMGGMAPQPEQDGDSEGGDQNSMLPVFVAGGLALLVV
VGVLVRRYRRGDDDIEV
Download sequence
Identical sequences G0HWR9 V5TLK1
gi|344211280|ref|YP_004795600.1| gi|564289273|ref|YP_008875510.1| WP_014039907.1.67629 WP_014039907.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]