SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0IVU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0IVU4
Domain Number 1 Region: 7-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.78e-88
Family Cystathionine synthase-like 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0IVU4
Sequence length 382
Comment (tr|G0IVU4|G0IVU4_CYCMS) Aminotransferase class V {ECO:0000313|EMBL:AEL24861.1} KW=Complete proteome; Reference proteome OX=880070 OS=marinus). GN=Cycma_1089 OC=Cyclobacterium.
Sequence
MNELASLYFDNAATTSIDERVLEEMLPFLKHNFGNPSSVHSHGRDARAALEKARKKISGL
LNVSPGEIIFTSGGTEADNMAICGAIATYNIKHIITSPIEHHAVLHVAEQLAKKQNLKLS
LLECDNQGRLNMEQLAMLLENEPNSLVSLMHGNNEIGNLNDIKKIAALCEQHSSYFHSDT
VQTMGHYPIDLKTLPIHSLSGSAHKFHGPKGVGFIYINKNKKIDPFIFGGGQERSFRGGT
ENVAGIIALAKALELAYENQTAHAEEILGIKTYFKNQIIKAIPEVTFNGLSGNLDESLYT
VLNVSFPPSESNEGMLLFHLDLNGISVSGGSACSSGAQLGSHVLNALGTNPQRENVRFSF
SRFNTKAEVDRVVKTLADLYLP
Download sequence
Identical sequences G0IVU4
WP_014019158.1.78327 gi|343083797|ref|YP_004773092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]