SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0J144 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0J144
Domain Number 1 Region: 49-341
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-29
Family Cystathionine synthase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0J144
Sequence length 407
Comment (tr|G0J144|G0J144_CYCMS) Selenocysteine synthase (Seryl-tRNASer selenium transferase)-like protein {ECO:0000313|EMBL:AEL25793.1} KW=Complete proteome; Reference proteome OX=880070 OS=marinus). GN=Cycma_2046 OC=Cyclobacterium.
Sequence
MISRRKLLKRLGTLPLAGGVLGAGVPLSVVKGETIEEAPKRNVIEELGLRSFINAAGTYT
AMTASLMPDEVMQTINFSSDHYIMLDEVQDKVGEKIAALCHAEYATVTAGCWSAMVLGTA
GVLTGKDKKKISQLPDLTGMKSQVIVQKSHNTGYVHALTNTGVEIVEVETAADVDRAVND
KTAMMWFLNYQGPSGKIKHEEWVALAKKHGLPTMIDMAADVPPVENLWKYNDLGFDLVCV
SGGKAIRGPQSAGILMGRRDLVEAARLSAPPRGGTIGRGMKVNKEEILGMYVALDTYIKK
DHDKEWKEWEDKIALISDAVSEIESVSTDVSVPPVANHTPYLEIGWDPAKIKLTQAELRE
KLRDGSPSIEVIGGGEHAVKLTVFMLRPKEEKIVAKRIAEELIKAKA
Download sequence
Identical sequences G0J144
gi|343084729|ref|YP_004774024.1| WP_014020088.1.78327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]