SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0L6A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0L6A2
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000000000824
Family PHP domain 0.01
Further Details:      
 
Domain Number 2 Region: 232-367,508-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000017
Family ABC transporter ATPase domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0L6A2
Sequence length 670
Comment (tr|G0L6A2|G0L6A2_ZOBGA) Uncharacterized protein {ECO:0000313|EMBL:CAZ96805.1} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_2655 OC=Flavobacteriaceae; Zobellia.
Sequence
MKKIDFHIHTVQSVSDRHFEFDIESLQEYVNLLKIDCIAITNHNLFDKIQFEEICKKLEI
KVFPGIEIDLEGGHLLLISENDILDDFALKCQKVKDLIPTKDDSINYEQLIDIFPNLKDY
LLIPHYDKKPNIKPITLEKLGDNIIAGEVTSLRKFKTCIKEADKLTPLIFSDCRFVENMS
SYPTRQTYVDVEETTLNAIKGCLYDKTKVFLSEEDGNDFFQATDDGIMLSTSLNVIVGGR
SSGKTYTLDKICENFDNVKYLRQFSLLQNDKENFKKLVTTRHSLVTENYLKEFKDVVLDV
NEIDLKSNEISLDKYLISLKKYASETNNLDTFSKCKLYNETKFTLDSLENLKKLISATET
LLETNEYKDIVNKHATDISLKNLAIELIQKYNELYEQNLKKDWTNNLIESIKDSLKFRST
TTSIEEVDFSKIQSEKIKVEKFIKLVKNVQSEKIIDSKEIRGFKVLAKTKQYTGAGQLKK
KSKTNLRFSDAFNNYENPYKFLISLQNVGIEETEFYKYFVDIDYRTLNKHGYEVSGGERS
EFNLLHEISDALKHDLLLIDEPESSFDNIFLKSEVNELIKEISKEIPVIVVTHNSTIGAS
INPNHLVFTQKTVNAGNVDYKVFFGHPTSKILKSVGGETIKNLDVLLNCLEAGEDAYNQR
NITNYEILKD
Download sequence
Identical sequences G0L6A2
gi|340618631|ref|YP_004737084.1| WP_013994001.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]