SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0MEV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0MEV0
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily PapD-like 1.16e-28
Family MSP-like 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0MEV0
Sequence length 109
Comment (tr|G0MEV0|G0MEV0_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT52087.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_03790 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSLTADPPACTVPAAGGTSTHKLINAGAEKMIFKIKSSNNNEYRISPVFGFVDPSGSKDI
QITRTAGGPKEDKLVIHFAVAPADATDAQAAFASVTPAGTVTIPMSATA
Download sequence
Identical sequences G0MEV0
CBN03790 135651.CBN03790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]