SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0MZX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0MZX6
Domain Number 1 Region: 87-230
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.2e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0MZX6
Sequence length 436
Comment (tr|G0MZX6|G0MZX6_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT48605.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_02761 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSMMTSQLMENKRNPASGDHELIRSDSGVELKSLLKLIDNVIEMAPATDEPEDTVTSNSI
PSFSMPPPLVMPSALQCMDPMVGYVTLSETLMVPVKKFPKYNFVGRILGPRGMTVKQLEK
ETGCKIFVRGRASNSVSNPASKVNRLAPKISNNNPNHPSRPSLSNISKCSLTEDPLHVYI
ECYDLPESGAQKMANAVAIIKDLLSPPADGKDELKRQQLVDISLINGTYRATSASSEIVR
QFRRAPFRQTVDPTSNPIQDLELEPLQMDIDGNAQIGGSASHADLGSVYGIAQQRRVWQK
PRGPDTLSEEYAKSVSSREFVSDIVNKTKKSPVKNQSNDSLFQLPDTVVNKTLKVAQNLL
ASHKHLAFGIHEQHHKTAAMHHGAGDFPQLPDFSVPPPPLHSLPHHQYNPYQEYPHMYYM
YTQPQQSYHPDYSHHY
Download sequence
Identical sequences G0MZX6
CBN02761 135651.CBN02761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]