SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0PLX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0PLX4
Domain Number 1 Region: 21-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.94e-23
Family Calponin-homology domain, CH-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0PLX4
Sequence length 346
Comment (tr|G0PLX4|G0PLX4_CAEBE) CBN-EHBP-1 protein {ECO:0000313|EMBL:EGT36026.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_17198 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRKLIYVLCKSERSNPPRAPSRDAFPQPVTEETLLSWCQRVTNGYSHVKIADFTKSWKNG
LALCSILHTYRPDLIGDYESLDISNNMSGQISNVKKALDALSMMGITDIPTVDMFLTPDK
KQIEILLQRLRRIFEGCEDGSTPASASDHWISRIFGIMETEEKVVAMIAELRNKKDLEDA
VDYSNIPDEVPSTPQFASQNKSLNQPIDDDDDETETSNMQFERSNVRLTMVTPGVGTYRA
SNRASPSKRDELRQRAREMLEKTVTPSATSNSRKGSDEERRREEVRRLLNEKQQSTAIPS
TSSSPYPTFRRLNGSNTDLRRIELDVHKFKKRDPSPTLVRKQCTVY
Download sequence
Identical sequences G0PLX4
135651.CBN17198 CBN17198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]