SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0RA62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RA62
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily EF-hand 1.53e-54
Family Calmodulin-like 0.000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0RA62
Sequence length 190
Comment (tr|G0RA62|G0RA62_HYPJQ) Calcium sensor protein {ECO:0000313|EMBL:EGR52071.1} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_75001 OC=Trichoderma.
Sequence
MGKSQSKLSQEQLAELQKSTHFDKKELQQWYKGFLKDCPSGMLSKEEFQKIYRQFFPFGD
PSSFADYVFNVFDSDKSGSIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKISYDE
MLQIVEAIYKMVGSMVKLPEDEDTPEKRVKKIFRMMDKDENGSLDMEEFKEGSKRDETIV
SALSLYDGLV
Download sequence
Identical sequences A0A024SJU4 A0A2H2ZLS1 G0RA62
51453.JGI75001 jgi|Trire2|75001|estExt_GeneWisePlus.C_20900 jgi|Trilo1|349839|MIX6065_26680_81 jgi|Triha1|204808|CE34959_25041 XP_006962433.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]