SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0RC69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RC69
Domain Number 1 Region: 200-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 1002-1098
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.47e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 853-959
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.5e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 1171-1263
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 5 Region: 692-770
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 762-853
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 7 Region: 356-443
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000111
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0RC69
Sequence length 1270
Comment (tr|G0RC69|G0RC69_HYPJQ) Predicted protein {ECO:0000313|EMBL:EGR51456.1} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_120418 OC=Trichoderma.
Sequence
MASEGSAPAVVANGGEESVAQRLQQHHVTVEDAPDEELSSQAADDASPAAAPGPSVTKTP
AKRQQAALDTQSRELFPELGAPRGKSPNVVPIWGARSDANGGSNGVSPSSTPVSGSTTPA
PLAHVRIPGHSDEIIKLDPGHVRPEMRRGLEGLLKKIGKRFNTPITVSTGNNGQLQFRAT
GPQAVAQQALKDVVSQIGSKVVIQVPIPQSTRPFIIGKGGATIKAIQEKTGAKIQMPKAD
ENQPVDRQDDEALVSVTVEGNSLTAAAAQREIENIVNERSANVQTRVPGVPTAFYPFIAG
PGHSLAHEIEQANGVQLRVPTNQLYSSAPLPVAPAAGGRPVFAPAGADDEHIQLAGDRRA
VQRVRELITRRVAELQRELEAEQLSIQRGRHQFIIGQRGIPLEDFFRETGCAIVFSQEED
DDMVTVVGPPSQVQAGVERAMDLAMGMQMSNIDIARSHRNAPGGAMAHAANVTRYLRQRK
EIERLEKQYNTHINTPFSQDGALPWELYSREGKNALRAQSEITAILNGHPPSRMQTVAVD
PFFHQHLRNEITPKVKKDFGVQLVVPDASEANAPVLLVFEGPDPAEGAYQPPRVKPSDAE
LRTFKQALDAAQKHILGLINKQEAIIAVSLDVPAKFHEKLRRFIKKEQESRDESQIPIRV
TKVGNIVTLRGPKSAVESLASKATAFIEQEKIDEKERGYTLTFDFPQKFANHLIGKGGSK
IKELRDRFDVEIQVQDGKVELKGPQAKAEKARTYIQNLGRTLADETTHILKIDPKYHREL
IGAQGSQINRLQTRYNVLIFFPKSAKNGDDQASEAASEAGKPRRQQAPDEVIIRGPKKGA
DEARDEIYSLHKYLEEHSHTATVGVQQKQVGSLIGQGGAALDELRQLTGARIDVPADRDT
PIVEISIKGTAAQVKKAKQILEEKRAEFDDTIVQTIEVDKKHHKALIGAGGSTLRDIVTG
AGGSDDRRALARTIQFPKQESDGNTIKIEGRTEVVQNIIKKIQEIVAERESQVTEVVDVP
IDQHRSLIGRGGDAKRQLESQFGVSIDIPRQGDGKTGVKVTGRAENVAKAKEHISGLIKQ
QHSETLEIPRSLHHVVSNGGQIFRQLRNNYQVTVDHAGQSIPAKPTPSARAVEGALPLIT
DDVDAAADVHSWKVVSLQSGDEGEIPWVLRGTPENVTKAKELIQKNLEQAKANDATGYLI
LPDPKTYRFVIGPNGSKVKSIRSQSNCQIQVPRDQAKDEAIEILGTREGVEKAKDLILAA
VREGQSKSRD
Download sequence
Identical sequences A0A024SJJ4 G0RC69
jgi|Trire2|120418|estExt_fgenesh5_pg.C_30308 XP_006962937.1.9351 51453.JGI120418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]