SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0RDC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RDC7
Domain Number 1 Region: 162-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0RDC7
Sequence length 257
Comment (tr|G0RDC7|G0RDC7_HYPJQ) Predicted protein {ECO:0000313|EMBL:EGR50788.1} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_120571 OC=Trichoderma.
Sequence
MPAPTALKKTESTPLVADVPSPAQDNDQEFLLDAPDAAVAEAEVLVPETTDASNSMAIDE
EGRPRFAPSKDIDPMTRVETRKIPIPPHRMTPLKQAWPSIYPPIVEHLKLQCRMNIARKT
VELRTSKSTVDSGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIETFEIKDVKTVHGDS
QSRAIGRIAGHQGKTKFAIENASRTRIVLADSKIHILGGFKNIHMARESVVSLILGKPPG
KVYGNLRTVAARMKERF
Download sequence
Identical sequences A0A024S9C4 A0A2H2Z6V5 G0RDC7
jgi|Trire2|120571|estExt_fgenesh5_pg.C_40050 XP_006963342.1.9351 51453.JGI120571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]