SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0RG72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RG72
Domain Number 1 Region: 65-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000164
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 142-230
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  G0RG72
Domain Number - Region: 7-54
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0596
Family ECR1 N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0RG72
Sequence length 232
Comment (tr|G0RG72|G0RG72_HYPJQ) Predicted protein {ECO:0000313|EMBL:EGR49807.1} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_76828 OC=Trichoderma.
Sequence
MSSEPIFVLPGDRIDASLIPSHEKKPLRLGPGLRHVPPSDLVPTLAGQLVTDRQKNAIRV
ETANGRYIPRVGELVIGTVNKSAQEVYFVSLSDYTAPALLPQLSFESATKKTRPILLPGA
LVYARCVSASTGKADGLGPLVGGMLFTISLGMSRLLMMPKKAQQGRLVVLDELADAGVQF
ETATGRNGRLWVDSDSTKAIIAVGRAIQETDEKSLGVDEQRRLVKKLIKELS
Download sequence
Identical sequences G0RG72
XP_006964167.1.9351 jgi|Trire2|76828|estExt_GeneWisePlus.C_60405 51453.JGI76828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]