SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0RVE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RVE5
Domain Number 1 Region: 33-99
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 7.98e-23
Family Hydrophobin II, HfbII 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0RVE5
Sequence length 102
Comment (tr|G0RVE5|G0RVE5_HYPJQ) Hydrophobin {ECO:0000313|EMBL:EGR44794.1} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_123967 OC=Trichoderma.
Sequence
MQFLAVAALLFTTALAAPSSDVNGIIRRANAFCPEGLLYTNPLCCDLDVLGVADVDCVVP
PAKPSSCKSFGSVCASIGRKPRCCAVPVAGVALLCTDPIPAI
Download sequence
Identical sequences A0A024RXA3 G0RVE5
XP_006969202.1.9351 jgi|Trire2|123967|estExt_fgenesh5_pg.C_290049 51453.JGI123967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]