SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0ZTL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0ZTL5
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-32
Family Duffy binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0ZTL5
Sequence length 134
Comment (tr|G0ZTL5|G0ZTL5_PLAFA) Erythrocyte surface protein {ECO:0000313|EMBL:AEM00228.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=EMP1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
FALARSFADIGDIIRGKDLFLGYTKKDEKEKEKVQKNLKRIFNEIYKKMQDPAKSHYSGD
SSDFYKLREDWWALNRKEVWKAITCKAKNDAEYFRKKDSDGKHCSVQNCKCVDGDPPTNL
DYVPQHLRWFDEWA
Download sequence
Identical sequences G0ZTL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]