SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1K230 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1K230
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 7.78e-51
Family C-type lysozyme 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1K230
Sequence length 147
Comment (tr|G1K230|G1K230_BOVIN) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKALLILGLLLLSVAVQGKTFERCELARTLKNLGLAGYKGVSLANWMCLAKGESGYNTQA
KNYSPGFKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSALLKDDITQAVACAKKIVSQ
LGLTAWVAWKNKCQNRDLTSYVQGCRV
Download sequence
Identical sequences G1K230
ENSBTAP00000031167 ENSBTAP00000031167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]