SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1K9U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1K9U9
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.52e-69
Family BAR domain 0.00031
Further Details:      
 
Domain Number 2 Region: 245-276,311-368
Classification Level Classification E-value
Superfamily SH3-domain 8.33e-17
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1K9U9
Sequence length 369
Comment (tr|G1K9U9|G1K9U9_ANOCA) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSACAP00000001683} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=SH3GLB1 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKLWTEKVM
KQTEVLLQPNPNARMEEFVYEKLDRKAPSRVNNPELLGQHMIDAGNEFGPGTAYGNALIK
CGETQKRIGAADRELIQTAAINFLTPLRNFIEGDYKTITRERKLLQNKRLDLDAAKTRLR
KAKVAEARAASEQEVRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSTFLANNNQSTTTCVPSSSNTTTAASSVSVTASLSSLSNVAAPS
SFGELKSSSGSRKARVLYDYDAANSTELSLLADEVITVYSIPGMDSDWLMGERGNQKGKV
PITYLELLN
Download sequence
Identical sequences G1K9U9
XP_003220158.1.98722 ENSACAP00000001683 ENSACAP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]