SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KB68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KB68
Domain Number 1 Region: 370-767
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.32e-41
Family Integrin alpha N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1KB68
Sequence length 836
Comment (tr|G1KB68|G1KB68_ANOCA) Glycosylphosphatidylinositol specific phospholipase D1 {ECO:0000313|Ensembl:ENSACAP00000002715} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=GPLD1 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MEALKILSTLAIISTFCQSVIPCGLSTHIEIVHDYLEKEYISFNKLKYRHLISNWQDAYQ
AGRLYPDAFYSGICKNGIFHQVSEDTHWSPFLNASVHYIRNNYPQPWETATEKLVAFLFG
IASHMVADVSWHSLGIDQGFLRAMAAIDFHGSYADAHSAGDFGGDVLSQFELDFDYLAPN
WYVPVKDLLSIYKELYGQEVITEETIVDCAHLQFLELYGEVIGIAKIYPFYARKSPFLVD
KFHDYFLGGVDDMAFASNNIFQQTSQILAHGTSGCFIPENPLYIRCKDEQRYPTRSRPSK
TEHHSNKTSSLAKSVEKNINYTERGVYFDMPAWATNYLYFRNSAAAKGLTSVLTITQQES
SHHITKPTASYFLKTPYAKLGWAMISADLNQDGYDDLVAGAPGYSRLGHIQIGRVYIIYG
NKSGLPHTDLDLDQEADEILEGNKPSGRFGSSIAALDFNEDGVLDLAVGAPSVGSQELSY
RGFVYIFFGNRRGGGFHKTPNITIACQKIYCNFGWSLLAADVDGDGNHDLVVGSPYAPGR
GKQRGFVASFYSFFNRSSQGQLSVSDADWIVKGQTDYAWFGSSLSSVQLQNRTLLLIGSP
SWKSCTGMRCYFSDDTRQAVGRVYGYIPPNKRSWFTLTGDMDMGNFGSSLATGFLSVEGI
LRHVLVVGAPTQDSPSKFVFIPSVLHQAGAALMYDLREDTEPHLLSSFNGDRRFSRFGGD
VHLSDLNNDGLDEIIVTSPLRSKDIVAGVLEGESARIYIYSGNQTVSGKVTNQCKSWTTP
CPEDWAEYVIISPEEKSRFGSAVITVKSGQQNDIVVAAERSSVKARLSGRLFIYTF
Download sequence
Identical sequences G1KB68
ENSACAP00000002715 ENSACAP00000002715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]