SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KC61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KC61
Domain Number 1 Region: 740-986
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-62
Family Nuclear receptor ligand-binding domain 0.0000000633
Further Details:      
 
Domain Number 2 Region: 609-687
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-27
Family Nuclear receptor 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1KC61
Sequence length 988
Comment (tr|G1KC61|G1KC61_ANOCA) Nuclear receptor subfamily 3 group C member 2 {ECO:0000313|Ensembl:ENSACAP00000003608} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=NR3C2 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
METKGYRSYPESLDMERRWSQGSQSMEYTSAGAEEPTEERNNYMEIVNVSCVSGAFPNNS
AQGSNKEKSELLSCLQQDHNQPGISVSDIKTEPDSKELSATVAESMGLYMDSVRDADFTY
DQQNQQGSLNAGKMYQNVEQLVKLYKENGHHTSPLNTSSRPLRPSVDCANSMNGSIMPSI
MKNPRITQERSPPDCSPQSMTSSVCSPPGINSVTSTTPTNFGNFTVSSPVNQGTPLSCSP
NIENRGSMLHSPPHASNMGSPLSSPISSMKSPISSPPSHCSVKSPVSSPNNITMRSSVSS
PANMNSRCSIASPSNANNRSTLSSPAVSTVGSSMCSPVNGALSFPPSSTPVGPGTGQDIV
SSPDTKDVKGAPQIIFPKIEEIENAISNNEVANQMNLVRFIKPEPDGVFSSSCLGENSKI
HSEPPFSVSIKQESAKHSCSGAPFKGNQTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPI
SSFEDRCENSAFPNPGLSVGIKQEPEESSYYQENTLPSSAIVGVNSSGQSFHYRIGAQGR
ISLSRPLGREQSFQHMSSFPSVSTLVESWKSHSELSARRNDGYPVLEYIPENVSSSTLRS
VSSGSSRPSKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIR
RKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEPQQQQQPPPQSPEEGTTYIAPSKE
PSVNTALVPHLSAVSPALTPSPAMVLENIEPEIVYAGYDSSKPDTAEHLLSTLNRLAGKQ
MIQVVKWAKILPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYRHTNSQFLYFAPDLVFN
EERMRQSAMFELCQGMHQISLQFVRLQLSFEEYTIMKVLLLLSTVPKDGLKSQAAFEEMR
ANYIKELRKMVTKHPNSSGQSWQRFYQLTKLLDSIHDLVSDLLEFCFYTFRESQALKVEF
PAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G1KC61
28377.ENSACAP00000003608 ENSACAP00000003608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]