SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KC80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KC80
Domain Number 1 Region: 379-607
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-28
Family RecA protein-like (ATPase-domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 167-318
Classification Level Classification E-value
Superfamily DNA primase core 0.0000112
Family Primase fragment of primase-helicase protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1KC80
Sequence length 666
Comment (tr|G1KC80|G1KC80_ANOCA) Twinkle mtDNA helicase {ECO:0000313|Ensembl:ENSACAP00000003685} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=TWNK OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MWLPVRSLHHWCLRGRRVLSGRHPCRHYKKETLPSPDGPVPPASVTEIRQYLRAQDIPFH
DGYSCIHVPSVFVEEQQQVRHSYTLFIDKTTGRFVCTATLVEGNWQDFQASVELQHKGVA
GGSLEDIDKPRDHTGEDARHIWERAMPLWELLDEQETQEAKAKFGISSISNATLKRFGVR
YLRTAQALVFPWFSPRGTSLKGLKLLGVERQGETANYVENTLPRPSAYHNLFGLPLIGRR
DTEVVLTGRELDTLALHQATGLPILALPRGISCLPPGLLPYLEQFKRITLWLGEDLRSWE
AAKLFARKLNPKRCSLVQPSDQQLQPLEAFTRGLNLTKILRSALPAGHKAIISFRQLREE
VLGELANVEQVAGVKWARFPELNKLLKGHRKGELTVFTGPTGSGKTTFISEYALDLCMQG
VNTLWGSFEINNVRLAKIMLTQFAMGRLEEQLDKFDEWADRFEDLPLYFMTFHGHQNIKT
VMDTMKHAVYMYDITHIIIDNLQFMMGQEQLTVDRLAVQDYIVGTFRKFATENSCHVTLV
IHPRKEDEERELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQISKNRFDGDVGI
FPLEFSKTSLTFSSPIKAKTAKLKKMKDDNGVPPKKAPTGGASKKQRSQSPNHTTPETSP
NEPVKT
Download sequence
Identical sequences G1KC80
XP_003218523.1.98722 ENSACAP00000003685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]