SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KFC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KFC1
Domain Number 1 Region: 121-233
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.4e-34
Family Elongation factor TFIIS domain 2 0.0037
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 8.24e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000966
Further Details:      
 
Domain Number 3 Region: 251-300
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.67e-16
Family Transcriptional factor domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1KFC1
Sequence length 302
Comment (tr|G1KFC1|G1KFC1_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000006264} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=tcea2 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
AMGGEQEIVRIAKRLDKMVAKKSAEGAMDLLKELKSMPITLHLLQSTRIGMSVNALRKQS
TDEDVIALAKSLIKAWKKLLDASEDKGNEKKRNSLPTSSSRESGDSKDQSSIKRQDLPKT
PTTPKITTFPPVPITCDTVRSKCREMLTSALQTDNDYVAIGVDCEEMAAQIEAFELIYQD
VKNTDLKYKNRVRSRISNLKDSKNPDLRKNVLCGVITPEQIAVMTSEEMASNELKEIRKA
MTKEAIREHQMAKTGGTQTDLFTCGKCRKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWK
FC
Download sequence
Identical sequences G1KFC1
ENSACAP00000006264 ENSACAP00000006264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]