SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KJ69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KJ69
Domain Number 1 Region: 748-824
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000275
Family RUN domain 0.017
Further Details:      
 
Weak hits

Sequence:  G1KJ69
Domain Number - Region: 636-707
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0314
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1KJ69
Sequence length 850
Comment (tr|G1KJ69|G1KJ69_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000009486} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN= OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
SSSSSSSPSAPGRFADYFVICGLDTGTGLEPDELSALCQYIQASKAQDGGGRFISSTAEG
ENFEQTPLKRTFKSKVLAHYPENVEWNPFDQDAVGMLCMPKGLSFKTQADAREPQFHSFI
ITREDGSRTFGFSLTFYEEVTSKQICSAMQTLYHMHNAEYDILHTPPTNHKDNCSTIEDC
NGSSISKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRKALEQLHQAVTSPQPPPLPL
ESFIYNILYEVPLPPAGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENMIQ
LFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYL
MGLHSNGLDDRSKLELPQEANLCFVDIDNHYVELPEDLPQFPNKLEFIQEVSEVLMGFGI
SPEGNLHCSEIASKMKSLRTCDIVSDKRNGNIGGTTLNSYELLKENETIARLQALVKRTG
VSLEKVEVREEIGVKKNLKVQCDEEEFKVYQLNIQIREVFANRFTQMFADYEVFVIQPSQ
DKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPV
LRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTIDEAEKAIELRLAKIDHTAIHPHLLDMKI
GQGKYEPGFFPKLQSDVLSTGPTSNKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYI
QEARNLGSSIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHG
EVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKPTSGSFSTS
GTVGFYRVYK
Download sequence
Identical sequences G1KJ69
ENSACAP00000009486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]