SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KME1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KME1
Domain Number 1 Region: 32-466
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.15e-83
Family Integrin alpha N-terminal domain 0.00000000127
Further Details:      
 
Domain Number 2 Region: 706-930
Classification Level Classification E-value
Superfamily Integrin domains 1.18e-50
Family Integrin domains 0.0000722
Further Details:      
 
Domain Number 3 Region: 569-697
Classification Level Classification E-value
Superfamily Integrin domains 2.2e-32
Family Integrin domains 0.0000696
Further Details:      
 
Domain Number 4 Region: 461-568
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-18
Family Integrin domains 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1KME1
Sequence length 980
Comment (tr|G1KME1|G1KME1_ANOCA) Integrin subunit alpha 2b {ECO:0000313|Ensembl:ENSACAP00000012257} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=ITGA2B OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MARGFGSLGIPVPLWLFMGGFLPSHLPVWTLNLHASAPTVYAGPNGSYFGFALDFYRDGK
GRMNVVVGAPLANTSQPGVMEAGSVYLCPWGPSGGDCNPIEFDTKGDQVAQQGYIRMEVF
KSKQWFGASVNTWKDNIVACAPLQHWNAFVGQDQATKTPVGSCFLASEGLRRFSEYSPCR
DIRMQSFYSSISYGNDKRYCELGFSSAISNSGNAVFGGPGGYYFGGLIYSINASVIQSSL
PRLLWSVPSQYVTSDFSDWTYNDGYRGYSVALGEFNEDATSDEYVVGVPNKSQTKGVVEI
LTLKKIFRVLWTIPSEQIASYFGHTVAVADVNGDGKDDILVGAPLFMERRLDRKLYEVGR
VYLYLQHKTPNAYSNPWQRLTGTDVYGRFGMAIAPLGDIDQDGYIDIAVGAPFAGRDEGG
RVYIYHGGNDGLSASPKQFLENPFTGPAGFGFAIRGASDVDANGYPALNAELQLDRMKQR
FGRRVFLLQNSQSSRMFPLELSGKIPHTCQNVTAYLRDETDFKDKLSPIAVSLNFSLASI
SRVEELQPVLYGQLMIQEQTRIILNCGDDNICIPNLKLSAHTNEGSLLIGADNVLLIQVT
AVNDGEGAYEAELIVELPAGAYFQKASSSTQKLICNSRKENETRLVACEMGNPMKAGTEI
KVDVELSVSQLENAEDTISFMLQLKSKNSLNSSSNVLRLPVPVKVAAKMELLGISAPTAI
VLPVATDYKNNSMKADDYGPKVEHIYRLQNAGPSTVSGAELLVDFPNNFWDGFLLYITRV
NTEGNIACSPMNETNPLKLELQEPMTTPSSNRSIQEGRWRQKRDLSPVTPEEPAVMVNCS
SQICAVLHCQVGLLEKGQGAMVTIHAVLWLPSFRERPVEQFLIQSQAQFSVSGMPYHIQP
EVLPSGSAVAKTRIEWVNPDAERKIPVWWIIVAVLVGLLLLAAFIIILWKTGFFKRKRPP
TEDEEQLTNEPGAQSSGDGN
Download sequence
Identical sequences G1KME1
ENSACAP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]