SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KMX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KMX8
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-53
Family RUN domain 0.0000000309
Further Details:      
 
Domain Number 2 Region: 572-632
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000192
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.004
Further Details:      
 
Weak hits

Sequence:  G1KMX8
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.00523
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1KMX8
Sequence length 636
Comment (tr|G1KMX8|G1KMX8_ANOCA) RUN and FYVE domain containing 3 {ECO:0000313|Ensembl:ENSACAP00000012660} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=RUFY3 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MSALTPPSDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKFVPEAAEITASVKDLPGLRTPVGRGRAWLRLALMQKKLSEYM
KALINRREILSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLSATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEDMERVKEESSYILESNRKQAPKQDRTSDGQALSEARKQLKEETQLRLDV
EKELEVQIGMRQEMELAMKMLEKDVCEKQDALVALRQQLDDLRALKLELSFKLQSSDLGV
KQKSELNSRLEEKTNQMAATIKLLEQRLQLTERERQSLEEDNRLFKQEFGDKINSLQLEV
EQLIKQRGQLELELKRERDRWSHSRHRIQDNKNLHVHNKGFHKTGTQIDVGNRFLEGDSQ
RRIPVKDEKTVHPNKVPHGHQEENEQIPGPGKLELCQLCQEESTRSKRKNICKNCSGVFC
EDCSANELPLPSSINPECVCNQCHKHLIQQYSASPS
Download sequence
Identical sequences G1KMX8
ENSACAP00000012660 XP_008110371.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]