SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KMY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KMY6
Domain Number 1 Region: 180-194,356-593
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-64
Family Nuclear receptor ligand-binding domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1KMY6
Sequence length 605
Comment (tr|G1KMY6|G1KMY6_ANOCA) Nuclear receptor subfamily 2 group C member 1 {ECO:0000313|Ensembl:ENSACAP00000012672} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=NR2C1 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MATIEELAHQIIEQQMGEIVTDQQTGQKIQIVTALDQSATGKQFILTNHDGSTPSKVILA
RQDTTPGKFFLTTPDAAGVNQLFFTSPDISTQHIQILTDSSSTEQTLNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGTRDCVINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPVDVSREKPPNCAASTEKIYIRKDLRSPLTATPTFVTDNETTRSTGMLEPG
MFVNIHQSGVKNEPTVLMTADKVETCQGDLSTLANVVTSLASLSKSKDVSQSSPDLSMIE
SLSNGDTSLTELQQDENANTDVTRAFDTLAKAFNPGETASCQSSAESMEASAHLFGEETT
TSIVEIEGPLLSDVHVAFRLTMPSPMPEYLNVHYICESASRLLFLSMHWARSISSFQALG
QDNSISLVKACWNELFILGLAQCSQVMNVATILAAFVNHLHNSLQQDKLSADRGKLVMEH
IFKLQEFCNSMVKLCLDGYEYAYLKAIVLFSPDHPGLENVQQIEKFQEKAYMEFQDYITK
VYPDDTYRLSRLLLRLPALRLMSAAITEELFFAGLIGNVQIDSIIPYILRMETADYNSQI
IGHGV
Download sequence
Identical sequences G1KMY6
ENSACAP00000012672 ENSACAP00000012672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]