SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1L5A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1L5A0
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-33
Family Ras-binding domain, RBD 0.0028
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1L5A0
Sequence length 623
Comment (tr|G1L5A0|G1L5A0_AILME) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000002061} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=APBB1IP OC=Ailuropoda.
Sequence
MGESNEDIDQMFSNLLGEMDLLTQSLGVDTLPPPDPKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQHHAASLAVPDFSGAVALGYGANVTAVS
VSQYEDDLPPPPADPMLDLPLPPPPPEPLSQEEEAAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYTELQIERIFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLDNKGKKEGKETNEKMNAKNKESLLE
ESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYG
KTLYDNYQRAMERAGLASRWSNLGTVNAAPPAPSSTGLKTGTTQANGQIPQAAHSVSAVL
EEAQKHAETIKDKKPALGNHHLGAPRAPQLPKSSLPPPPPVRRSSDVCGSPATVPRAKGL
SGGFPAPPPSFAEAAGSPLPPPPPPPPAPAPEAAKPPPAGVKRAPVPPKRKENPGPPGGG
GSGEQDFMSDLMKALQKKRGNMS
Download sequence
Identical sequences G1L5A0
XP_002927568.1.58354 ENSAMEP00000002061 ENSAMEP00000002061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]