SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1LCU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LCU7
Domain Number 1 Region: 409-520
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-21
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 586-696
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 703-768
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 762-824
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000027
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 829-889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000996
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 349-413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 7 Region: 232-350
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000127
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number 8 Region: 525-589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000132
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1LCU7
Sequence length 988
Comment (tr|G1LCU7|G1LCU7_AILME) Seizure related 6 homolog {ECO:0000313|Ensembl:ENSAMEP00000004727} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=SEZ6 OC=Ailuropoda.
Sequence
LKPLLFFDLFPCLSNQAPRLSSEAPTTGEGQAPGIEEMDGELTVAPTPEQPERGVHFVTT
APTLKLLNHHPLLEEFLQEGPEGGEEGLRPALPFQPDPPTPFTPSPLPRLANQDSRPVFT
SPTPAMAAAPTQPQSRERPWSLESESPVLRITTPLPPVPSPGPGEGPSTTPPSRAWTPTQ
EGPGDMGRPWAPEVRSRTMGLGTEGTITTSTASGDDEETTTTIITTTITTVQPPGPCSWN
FSGPEGSLDSPTAPSSPTDVGLDCFYYISVYPGYGVEIKVQNISLREGETVTVEGLGGPD
PLPLANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLNCHFPQRPAYGA
VTVTSLHPGGSARFRCATGYQLKGARLLTCLNATQPFWDFQEPVCIAACGGVTRNATTGR
IVSPGFPGNYSSNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDS
YEVEYLPIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAP
SYPVGTTVEFSCDPGYTLEQGSIIIECIDPHDPQWNETEPACRAVCSGEITDSAGVVLSP
NWPEPYSRGQDCIWGVHVEEDKRILLDIRVLRIGPGDVLTFYDGDDLTARVLGQYSGPRG
HFKLFTSMADVTIQFQSDPGASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPE
LVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISNP
KFPVRATVQYICDQGFVLTGSAILTCHDRQASSPKWSDRTPKCLLEQLKPCHGLSAPENG
AHSPEKRLHPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDGFYSGR
SLDVAKAPAASSTLDAAHIAAAIFLPLVVMALLVGGVCLYFSRLQGKSPPLRLPRTRPRP
YDRITVESAFDNPTYEIGSLYFAGDERI
Download sequence
Identical sequences G1LCU7
ENSAMEP00000004727 ENSAMEP00000004727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]