SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1LNX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LNX2
Domain Number 1 Region: 44-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 252-369
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000017
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 165-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 211-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 447-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 408-445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  G1LNX2
Domain Number - Region: 383-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000445
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1LNX2
Sequence length 755
Comment (tr|G1LNX2|G1LNX2_AILME) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSAMEP00000008752} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=LRP3 OC=Ailuropoda.
Sequence
VFPTVNIVLTGRLSSAVPALGEAGAGRGRGEAGTSQPLLPTAACSGKLEQHTERRGVIYS
PAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRL
CGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCL
PGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPTERRCDGTQD
CGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLE
LRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFN
ATYQVKPCGSGGEGAAGDAGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGS
GLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCTWRCDGQEDCQDGSDEHGCL
AAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAP
PSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLFHR
PRVPRGQIPLLTAARTSQTVLGDGLLQPASGSTPDPPAPLTDTGSPVAAGDGPPSAPGHG
PEVGSAVLPPSGLRDPECRLVDKDRKAGRDPLVDSPAPVDMPREPCTAQDPHPPAPTASS
TLGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences G1LNX2
ENSAMEP00000008752 ENSAMEP00000008752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]