SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1LPG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LPG6
Domain Number 1 Region: 13-134
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.53e-28
Family Hormone receptor domain 0.00014
Further Details:      
 
Domain Number 2 Region: 121-403
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000128
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1LPG6
Sequence length 438
Comment (tr|G1LPG6|G1LPG6_AILME) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000008946} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=VIPR2 OC=Ailuropoda.
Sequence
IAAKLVPTTYNVLYLDQVNSVHPECRFHLEIQEEETKCAELLRTQTEKYKACTGVWDNIT
CWRPADVGETVTVPCPKVFSNFYSKPGNISKNCTSDGWSEMFPDFIDACGYNGAEDESKI
AFYILVKAIYTLGYSVSLVSLTTGSIILCLFRKLHCTRNYIHLNLFVSFILRAISVLIKD
DVLYSRSGTLHCPDQPSSWVGCKASLVFFQYCIMANFFWLLAEGLYLHTLLVAIFSPSRR
FAAYLLIGWGIPTVCIGAWTAARLSLEDTGCWDTNDHSVPWWVIRAPILISIIVNFVLFV
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYVVFAVFPIGISSKYQILFE
LCIGSFQGLVVAVLYCFLNSEVQSELKRKWRSLCPSRPCGQDYRLHSSSVSRNGSESALQ
FHRGSRAPSLLQTETSVI
Download sequence
Identical sequences G1LPG6
ENSAMEP00000008946 ENSAMEP00000008946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]