SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1LSE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LSE6
Domain Number 1 Region: 109-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-29
Family Second domain of FERM 0.0029
Further Details:      
 
Domain Number 2 Region: 218-344
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-19
Family Third domain of FERM 0.006
Further Details:      
 
Domain Number 3 Region: 28-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000455
Family First domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1LSE6
Sequence length 445
Comment (tr|G1LSE6|G1LSE6_AILME) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000009986} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN= OC=Ailuropoda.
Sequence
EWELGASRVMGGRRSLRLCTPSPGPEPPHVLQVQATGRELFQQVCDMASLRDAHFFGLSV
VRNDEYVFMDLGQKLSGYFSKDWKQEGRKGSGRPRAPFVTFLRVQFYVEDGRLLSDRTAR
HLYYCHLKERVLRSQCAHREEAYFLLAAYGLQADLGNHREPVHVGRYFEPHAYFPPWIVA
RRGSAYILRHAPAVHREQRGLSPTEAVLRFIREACRLEDVPVHFFKLYKDKKDDRPTVIL
GLTLNGMQIYQETSHAPELLYDFPWSHIGKVVFLGKKFEVQPDGLPSARKLVFYTGCAWR
SRHLSSHQLRLVLQPALRRLRQREEAEEKKHYRESYISDTLDLDLDPGGRGSPGSPHSGG
SRDSGGSSQHLPHRLSVRSADSHGSSHTSGIEADARPLEPGEMSVDAALGAEAPRAEAPA
CSSSTSQSSHCTDGGSGDRPEGDTQ
Download sequence
Identical sequences G1LSE6
ENSAMEP00000009986 ENSAMEP00000009986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]