SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1LSR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LSR5
Domain Number 1 Region: 431-691
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-56
Family YWTD domain 0.0000000198
Further Details:      
 
Domain Number 2 Region: 261-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 3 Region: 54-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 4 Region: 135-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 13-50
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 6 Region: 347-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family EGF-type module 0.0025
Further Details:      
 
Domain Number 7 Region: 88-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 8 Region: 383-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000016
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 9 Region: 304-340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 10 Region: 702-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000366
Family EGF-type module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1LSR5
Sequence length 964
Comment (tr|G1LSR5|G1LSR5_AILME) LDL receptor related protein 8 {ECO:0000313|Ensembl:ENSAMEP00000010106} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=LRP8 OC=Ailuropoda.
Sequence
SGSRPLLPRAGPVKECEEDQFRCRNERCIPSVWRCDEDDDCSDNSDEDDCPKRTCADSDF
TCGNGHCIPERWKCDGEEECPDGSDESETTCTKQVCPAEKLSCGPASHKCVPASWRCDGE
KDCESGADEAGCASLCAPHEFQCSNRSCLAAVFVCDGDDDCGDGSDERGCADPACGPREF
RCGGGGPCRKPPLPCTARPRRPLQAGLRRGLPERTRSAPAPRAPVTWVTVGRRLGEGGIL
GWRSPGSSRPCLPYLRGLPLTLGTCRGDEFQCGDGTCVPTIKRCNQEQDCLDGSDEAGCL
QESTCEGPRRFQCKSGECVDGGKVCDTQRDCQDWSDEPLKECGLNECLHNNGGCSHICTD
LKIGFECTCPTGYQLLDQKTCGDIDECEDPDACSQICINYKGYFKCECHSGYEMDTLTKN
CKAVAGRSPSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRK
IYSAYMDKASDPAEQEVLVDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATIDGGRRCT
LFSRDLSEPRAIAVDPLRGFMYWSDWGYQAKIEKSGLNGADRQTLVSDNIEWPNGITLDL
LNQRLYWVDSKLHQLSSIDLSGGNRKMLISSPDFLSHPFGIAVFEDKVFWTDLENEAIFS
ANRLNGLEISVLAENLNNPHDIVIFHELKQPRAADACELSAQPNGGCEYLCLPAPQISSP
SPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLAPTTARTLADTTRAPGATVHSLTHQNH
STETPSLAAAVPGSVSVPRAPSIKPSTPSPATSNRSQHYGNEGGKMGSTVTAAVIGILVP
MVVIALLCVSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAN
SFLPCPPPFFPPPSLLPSPPPFLPSFLSSFPRSQLHQLPKNPLSELPVVKCKRVALSLED
DGLP
Download sequence
Identical sequences G1LSR5
ENSAMEP00000010106 ENSAMEP00000010106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]