SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1M1S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1M1S6
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000425
Further Details:      
 
Domain Number 2 Region: 242-334
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.88e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 397-457
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000301
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1M1S6
Sequence length 469
Comment (tr|G1M1S6|G1M1S6_AILME) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSAMEP00000013287} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=WAS OC=Ailuropoda.
Sequence
MSGGPVGGRSGGRGGPGVQQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQTGRLLWEQELYSQLVYSTPTPFFHTFAGD
ACQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLPAPPAPANEERRGGLPPLPPH
PGGDQGGLASGQLSLGLVTVDIQNPDITSSRYRGLPVPGPGPAEKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQAPRPPTMGSSKGRSGPLPPVPLGGAPPPPTPXXXX
XXXXXXXPPPPPPSSGDGPIPPPPPALGPTGALAPGGGGALLDQIRQGIQLNKTPGAPES
SALQPPPQSSEGLVGALMHVMQKRSKAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences G1M1S6
ENSAMEP00000013287 ENSAMEP00000013287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]