SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1M6K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1M6K0
Domain Number 1 Region: 780-987
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.12e-76
Family STAT DNA-binding domain 0.00000000734
Further Details:      
 
Domain Number 2 Region: 29-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.48e-75
Family STAT DNA-binding domain 0.000000518
Further Details:      
 
Domain Number 3 Region: 599-780
Classification Level Classification E-value
Superfamily STAT 1e-62
Family STAT 0.0000000141
Further Details:      
 
Domain Number 4 Region: 466-586
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 6.02e-45
Family Transcription factor STAT-4 N-domain 0.0000178
Further Details:      
 
Domain Number 5 Region: 988-1129
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-44
Family SH2 domain 0.00000012
Further Details:      
 
Domain Number 6 Region: 228-344
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-41
Family SH2 domain 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1M6K0
Sequence length 1169
Comment (tr|G1M6K0|G1M6K0_AILME) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=STAT1 OC=Ailuropoda.
Sequence
MTYEGDPIPMQRAHLLERVTFLIYNLFKKLLIKLPELNYQVKVKASIDNNRRFVLCGTHV
KAMSIEESSNGSLSVEFRHLGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNV
SQLPNAWASIIWYNVSTNDSQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNM
LAEKLTVQSSYNDGHLTWAKFCKEHLPGKAFTFWTWLEAILDLIKKHILPLWIDGYVMGF
VSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALP
FADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEAPGPFPRKHVGRLFRA
VASLPPHALRRNSSAPVVGSVWVLSKMSRGNRQPAGLQHRAGFTSPPTGPYSKGWRGYFY
VTELYRPTISFLFFGRPARQDSHVPALHIASCALVPRLCAVFPYRMSQWYELQQLDSKFL
EQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLEN
NFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILENAQRFCQAQSGNIQSTVM
LDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNREHEANGVAKNDQKQE
QMLIQKMYLMLDNKRKEVVHKIIELLNVTELTQKALINDELVEWKQRQQSACIGGPPNAC
LDQLQNWFTVVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQGLWDRTFSLFQQLIQR
LLVKLQELNYNLKVKVLFDKDVNERNTVKGSEPFKYFCSVLSRFRKFNILGTHTKVMNME
ESTNGSLAAEFRHLQLKEQKNAGTRTNETTSLPVVVISNVSQLPSGWASILWYNMLVTEP
RNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWTR
FCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFLL
RFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPE
NPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTD
NLLPMSPEEFDEVSRIVGSVEFDSMVSTP
Download sequence
Identical sequences G1M6K0
ENSAMEP00000014970 ENSAMEP00000014970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]