SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MI83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MI83
Domain Number 1 Region: 562-672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 385-496
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-20
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 679-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000076
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 214-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000051
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 5 Region: 738-800
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000653
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 806-865
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 326-387
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000486
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 501-565
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000054
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MI83
Sequence length 958
Comment (tr|G1MI83|G1MI83_AILME) Seizure related 6 homolog like {ECO:0000313|Ensembl:ENSAMEP00000019068} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=SEZ6L OC=Ailuropoda.
Sequence
ENRGSKAADTNQSSKETTMELATMECLLVALWSLSALSPILSQWASPPRALPSGKKPPSL
KQVNSARKQLRPKATSTAAVQRAANPPASPGLGLLSSATEKLRPPGDPEPSASEEPRWLD
RKAGAVPTTPAPLQISPFTSQPYVAHTLPQRPDPGEPVAPDDAPEAPPEDASPMTLMDKG
ENELTGSASEESQETTTTTIITTTVITTEQAPAPCSVSFSDPEGYIGSSDYPPLPLSGFL
ECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLANQTLLVEGQVIRSPTNT
ISVYFRTFQDDVLGTFQLHYQAFMLSCNFPRRPDYGDVTVMDLHPGGVAHFHCHLGYELQ
GAKTLTCMNASKPHWSSQEPVCSAPCGGAVHNATIGRVLSPSYPGNTNGSQFCVWTIKAP
EGQKLHLHFERLSLHEKDRMMVYSGLINKSALLYDSLQTENVPFEGLLSEGNGIRIEFLS
DQARAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTVVEFTCDPGHSLEQGPAI
IECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCIWKIHVGEEKRI
FLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPAGLIF
GKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARVTYQCDPGYDIVGSDTLT
CQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLL
TCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFE
LMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAETAAETSLEGGNMALAIFIPVL
IISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences G1MI83
ENSAMEP00000019068 ENSAMEP00000019068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]