SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MIA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MIA4
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.53e-20
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MIA4
Sequence length 798
Comment (tr|G1MIA4|G1MIA4_AILME) Erythrocyte membrane protein band 4.1 like 4B {ECO:0000313|Ensembl:ENSAMEP00000019089} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=EPB41L4B OC=Ailuropoda.
Sequence
KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSSQVTHWLDHSKPIKKQMKIGPAYALHFRV
KYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHT
PELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGR
DGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFV
FRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSSRSDFIRLGSRFRFSGRTEYQATHGAR
LRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQFCSKTNPEVHNYQPQYHPNIHPSQPRW
HPHSPNVSYPLPSPGLSSSDRLPFSIEENGGTTRASARHHHHHHHQHQHQHHPNYGLSLT
LENKEGPSRSPNSSSKSLTKLSPGPPALFSEAAAHLKKLELETVKAAGPWPALHININKA
EEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVSAQVGKEESTFVNINKKSSLQD
ANVRSPIPIRVETTQPAVEKPEIKPPRVRKLTRQYSFNRSDEDDLPPDLAEAVGAPTAAA
ANPVTATSQVSAPLVSPKGHKLSSPQTSESKGQLSPGAKSPSDRRGAFTLEPGDLLMDFT
EATPLAEPASAPHCAHSRCSPPLSPPMKEETTGVCMHPPIKTRLIKTFPADTVTPFPDAF
NSGPQFTADFRDSKLPCCPGQSSPLIPAVTLRPLTETMSTVPTIYTTRKPVSLAASAETL
RQELEREKMMKRLLMTEL
Download sequence
Identical sequences G1MIA4
ENSAMEP00000019089 ENSAMEP00000019089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]