SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MIV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MIV5
Domain Number 1 Region: 97-213
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000168
Family PX domain 0.0032
Further Details:      
 
Domain Number 2 Region: 297-352
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000149
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 884-913
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000541
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MIV5
Sequence length 937
Comment (tr|G1MIV5|G1MIV5_AILME) Zinc finger CCHC-type containing 14 {ECO:0000313|Ensembl:ENSAMEP00000019290} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=ZCCHC14 OC=Ailuropoda.
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGHGGCGAPGPRGGLPICPSSFKVTPRTEA
PVSSVSNSLENALHTSAHSTEESLPKRTVGKHSKVSVEKIDLKGLSHKKNERNVECSFEV
LWSDSSVTSVTKSSSEVTEFISKLPQLYPEENLEKFIPCLAGPDSFYVERNHMDLEADLR
YLASLPSHVLKNDHVKKFFSTSSPTQQLQSPSPGTPSISKVGTMMGVSGRPVCGVAGIPS
SQSGAQHHMQHSASAAALPHCSHTGGASPALAYRAQMDTSPAILMPSSLQTPQPQEQNGI
LDWLRKLRLHKYYPVFKQLTMEKKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEK
RCLNPTAPPPVTSSGVARVPPTSHVGPVQTVRGTHAAALRVEVEQPPQQTAREGSSSECS
SSSPSPMGVQAREESSDSAEESDRRVEMHLEGSEKEKPVMLLNHFASSSARPTAQVLPVQ
NEAGSSPSGHHPLPPQMMAAASHLAPIRMLNSVHKSERGGADMKLLPPSVHSLLSLEERS
KLSGPRGGIKVDKNFGHAVIDAAPTPTPQQPLQVLSALAESSSVSPTVSFGPRAKVVHAS
ALDRVIKPAPQPAPGGEASTAAAGTSSTVFHVARPPIKLLVSSSVPADSAISGQTPCSNN
VQISVPPAIINPRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTASSSSHPSTSFASM
ATVPSCPAPSSSPALSSAPESSFYSSSGGGGGGGSPHHQQQSAPQQPTPAPPPGCVVCTS
CGCSGSCGSGLTVSYANYFQHPFSGPSVFPFPFLPFSPVCGSGYVGAQQYGGGAFPVVHS
PYGGSVPPEPVLGGQSAFAVPPLQSFMAGAAGVYQAPGLVGSSSGSGHKKSGNLSCYNCG
ATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences G1MIV5
ENSAMEP00000019290 ENSAMEP00000019290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]