SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MPX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MPX7
Domain Number 1 Region: 296-510
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-52
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 814-1081
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000117
Family WD40-repeat 0.0078
Further Details:      
 
Domain Number 3 Region: 523-606,701-759
Classification Level Classification E-value
Superfamily PH domain-like 0.000000112
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MPX7
Sequence length 1255
Comment (tr|G1MPX7|G1MPX7_MELGA) Rho guanine nucleotide exchange factor 10 like {ECO:0000313|Ensembl:ENSMGAP00000000097} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGEF10L OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MASSQLPPCPTVGTVLASQPPSELPPGEEDLGEAFDFEDSDEEEDEDSATEPSRLPPSSG
CPSLVLCLSFPISFPVAAEFAPWVRLPEQVSNGEACEDPPDINTQTWKRKSGHQGDRFEF
TAAEDDVIYDDVPCENLDANQDGRRRSLIYEDVQRGEELGWSSSEFESYSEESGEENKPE
AEPAKHRASFQPKLSPDLNRLKETYARTKRDILALRVGGKDMQELKQKYDWKMTQLMKAA
KSGTKDGLEKTKIAVMRKVTFLHRKEVPGDSEEEDTGFLEVTVSDAKHPPPELGPMPTGL
SPQQVVRRHILGSIVQSERSYVESLKRILQDYRNPLMEMEPKVLSARKCQVVFFRLKEIL
QCHSMFQIALSSRVAEWDSAEKIGDLFVASFSKSMVLDVYSDYVNNFTTAMSLIKKACLT
KPAFLDFLKKRQMASTDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPKGHADRLSLQLAL
TELETLAEKLNEQKRVADQVAEIQQLSKSISDRSSLSKLLNSGQRQLLLCETLTETVYGD
RGQLIKSKERKVFLLNDMLVCANINFKPVNPRGQLEISSLVPLGPKYVVKWSTALPQVQV
VEVGQESGAYDKDNVVIHNAGAKKHAPTGPASHNKVYLGPPRLFQELQDLQKDLAVVEQI
TLLISTLHGTYQNLNMTVAQDWCLALQRMMKVKEEEIHSANKCRLRLLLPGKPDKSGRPI
SVMVVFITPNPLSKISWVNCLHLAKIGLREENQPGWLCPDEDKKSKAPFWCPILSCHMPA
FSSKALDLQLSAAVHNPVQSSLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRSVP
RTVKSFPVASPVLCMEYIPEAAEGDTEGTEEPRAGAEQPPATLHPTVCLGLRDGSIAVYS
SVDTGTQCLLTCKSPGTQPVLCLKHSPEYLFAGLQDGTVAAYPRNNVGLWDLTEQPTRLP
VGTSPVRALLMLDETLWASCANQVTVLDASTLCAQQTFEAHPDTEASVTHMIKAGSGVWM
AFSSGSSIRLFHTETLEHLQEINIATRTTFVLPGQRHVRVTSLLICQGLLWVGTDQGIIV
LLPVPRLEGIPKITGKGMVSLNGHGGPVDFLAVALSTLAPDVLKGDQEDEDGEEEKPLEL
DGPPPREIRKKGILLQYRLRSTSHLPGQLLSVRDAPVGTVTPEHTEEDGSIYEMADDPDV
WVRSRPCARDAPRKEISSVAIISGGRGYRNFNSEPQRRGGDADSTLLIWQLPLML
Download sequence
Identical sequences G1MPX7
ENSMGAP00000000097 ENSMGAP00000000097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]