SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MRF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MRF7
Domain Number 1 Region: 59-175
Classification Level Classification E-value
Superfamily PX domain 3.01e-25
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 3-42
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000134
Family PDZ domain 0.026
Further Details:      
 
Domain Number 3 Region: 186-249
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000136
Family Ras-binding domain, RBD 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MRF7
Sequence length 467
Comment (tr|G1MRF7|G1MRF7_MELGA) Sorting nexin family member 27 {ECO:0000313|Ensembl:ENSMGAP00000000765} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SNX27 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RKGAEALEMNGVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFY
DYTEKQAVPISIPTYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKREFANFT
FPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDV
ELRVALPDITTVTVRVKKNSTTDQVYQAVAAKVGMDSVTANYFALFEVINHSFVRKLAPN
EFPHKLYVQNYTSAVPGTCLTIRKWLFTTEEEALLNDNDLAVTYFFHQAVDDVKKGYIKA
EEKSYQLQKLCEQRKMVMYLNMLRTCEGYNEIIFPHCSCDSRRKGHVITAISIKHFKLHA
CTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFE
RVFCELKWRKEVEEEATDKDNQNCSTDTVCSKNIFQTVRSQQRDAAT
Download sequence
Identical sequences G1MRF7
ENSMGAP00000000765 ENSMGAP00000000765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]